Bacterial taxon 208964
Protein WP_003095090.1
pentapeptide repeat-containing protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9HV95
>WP_003095090.1|Pseudomona aeruginosa PA01|pentapeptide repeat-containing protein
MNSPRQLDSPLYQLLHAEDIEGFNRQKPADGWIDLAGGDFRGLDLRLLDAARVDFSDAYFRGADLRGVDLREARLEGASLAHAQISGTYFPLRLAPDEIRMSVNFGTRLRYLPEP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -4.05 | -4.04680080832376 | 5.5e-54 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 49.7 ms
(Link to these results)