Bacterial taxon 208964
Protein WP_003082429.1
periplasmic nitrate reductase, NapE protein
Pseudomona aeruginosa PA01
Gene napE, UniProt Q9I4G0
>WP_003082429.1|Pseudomona aeruginosa PA01|periplasmic nitrate reductase, NapE protein
MNEQPDQGRVKGMEARLFLFLVICLFPLLSVALVGGFGFCVWMYQLLAGPPGPPA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -5.14 | -5.14014667912826 | 8.7e-38 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)