Bacterial taxon 208964
Protein WP_003115119.1
phenazine biosynthesis protein phzB 2
Pseudomona aeruginosa PA01
Gene phzB2, UniProt Q9S508
>WP_003115119.1|Pseudomona aeruginosa PA01|phenazine biosynthesis protein phzB 2
MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -5.49 | -5.48796870989913 | 1.0e-36 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 39.3 ms
(Link to these results)