Host taxon 10090
Protein NP_067426.1
phorbol-12-myristate-13-acetate-induced protein 1
Mus musculus
Gene Pmaip1, UniProt Q9JM54
>NP_067426.1|Pseudomona aeruginosa PA01|phorbol-12-myristate-13-acetate-induced protein 1
MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.49 | 3.49284800114646 | 2.7e-138 | 32071273 | |
Retrieved 1 of 1 entries in 127.9 ms
(Link to these results)