Bacterial taxon 208964
Protein WP_003113662.1
PLDc N-terminal domain-containing protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9I1U5
>WP_003113662.1|Pseudomona aeruginosa PA01|PLDc N-terminal domain-containing protein
MSQSLAFLLIGLATLVGFYDLWAFVSVFRSDRSVNSKALWSLLIAVLPVLGVLIWAVAGPRAATARPRD
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -7.21 | -7.20767944867155 | 4.2e-9 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 3.6 ms
(Link to these results)