Host taxon 10090
Protein NP_001153107.1
probable RNA-binding protein 18 isoform 2
Mus musculus
Gene Rbm18, UniProt Q9CR83
>NP_001153107.1|Pseudomona aeruginosa PA01|probable RNA-binding protein 18 isoform 2
METETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPAQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.88 | 0.876563637107988 | 1.1e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)