Host taxon 10090
Protein NP_001159364.1
proline-rich protein 3 isoform b
Mus musculus
Gene Prr3, UniProt Q811B5
>NP_001159364.1|Pseudomona aeruginosa PA01|proline-rich protein 3 isoform b
MPKRKKQDQPPPLPQQQQHLALSERDEPGDEEDERPMGQPSVNYSPEGRRGEKNYDGPTVKDHPAFWALPPWLTGSLVIPSQNVNISS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.09 | 5.09267820428822 | 0.00035 | 32071273 | |
Retrieved 1 of 3 entries in 0.4 ms
(Link to these results)