Host taxon 10090
Protein NP_082910.1
protein chibby homolog 1
Mus musculus
Gene Cby1, UniProt Q9D1C2
>NP_082910.1|Pseudomona aeruginosa PA01|protein chibby homolog 1
MPLFGSIFSPKKTPPRKSASLSNLHSLDRSTRELELGLDYGTPTMNLAGQSLKFENGQWVADSVISGGVDRRETQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLKDKELDELKVTNRRRK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.8 | -4.80061537884167 | 3.0e-8 | 32071273 | |
Retrieved 1 of 1 entries in 37 ms
(Link to these results)