Host taxon 10090
Protein NP_084275.3
protein LBH
Mus musculus
Gene Lbh, UniProt Q9CX60
>NP_084275.3|Pseudomona aeruginosa PA01|protein LBH
MSVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTNEKKDQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.56 | -3.56249681096562 | 3.2e-198 | 32071273 | |
Retrieved 1 of 1 entries in 42.9 ms
(Link to these results)