Host taxon 10090
Protein NP_001153074.1
protein myomaker isoform 2
Mus musculus
Gene Mymk, UniProt Q9D1N4
>NP_001153074.1|Pseudomona aeruginosa PA01|protein myomaker isoform 2
MGKGFSHACDGPGLSVLCFMRRDILEYFSIYGTALSMWVSLMALADFDEPQRSTFTMLGVLTIAVRTFHDRWGYGVYSGPIGTATLIIAVKWLKKMKEKKGLYPDKSIYTQQIGPGLCFGALALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKVNKKAGNAGAPAKLTFSTLCCTCV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.97 | 4.97100118728972 | 0.037 | 32071273 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)