Host taxon 10090
Protein NP_035330.1
protein tyrosine phosphatase type IVA 1
Mus musculus
Gene Ptp4a1, UniProt Q63739
>NP_035330.1|Pseudomona aeruginosa PA01|protein tyrosine phosphatase type IVA 1
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.35 | 3.34711819991722 | 1.1e-167 | 32071273 | |
Retrieved 1 of 2 entries in 105.6 ms
(Link to these results)