Host taxon 10090
Protein NP_899072.1
protein Wfdc21 precursor
Mus musculus
Gene Wfdc21, UniProt Q8BTE6
>NP_899072.1|Pseudomona aeruginosa PA01|protein Wfdc21 precursor
MKLGAFLLLVSLITLSLEVQELQAAVRPLQLLGTCAELCRGDWDCGPEEQCVSIGCSHICTTN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.37 | 3.36694494941967 | 8.8e-19 | 32071273 | |
Retrieved 1 of 1 entries in 85.7 ms
(Link to these results)