Host taxon 10090
Protein NP_001013821.1
protein-lysine methyltransferase METTL21C
Mus musculus
Gene Mettl21c, UniProt Q8BLU2
>NP_001013821.1|Pseudomona aeruginosa PA01|protein-lysine methyltransferase METTL21C
MDQHLHIAQQPLLSGTPQEDGFAGPSVEFDRIESSLRSIQKFVPTDYASYTQEHYQFAGKKIIIQESIENYGTVVWPGATALCQYLEDHTEELNLQDAKILEIGAGAGLVSIVSSLLGAQVTATDLPDVLGNLQYNILKNTLECTAHLPEVRELVWGEDLEQSFPKSTCCYDYVLASDVVYHHYFLDKLLATMVYLSQPGTVVLWANKFRFSADYEFLGKFKQAFDTTLLAEYSESSVKLFKGILKWE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.04 | 3.04089080889206 | 0.01 | 32071273 | |
Retrieved 1 of 2 entries in 3.8 ms
(Link to these results)