Host taxon 10090
Protein NP_058610.1
proteoglycan 3 precursor
Mus musculus
Gene Prg3, UniProt Q9JL95
>NP_058610.1|Pseudomona aeruginosa PA01|proteoglycan 3 precursor
MKQPLILSFLLLGMVSAFHLETAHLENPKREESLKQEADGSREQGRELALTQETKQTEGEEVEGSQHQDIFEDEEAMESDPDALNKDSACPKEEDTTHFQGTPGCKSCNYVLVRTPETFDKAQRVCRRCYRGNLASVHSYSFNYQIQNLARKINQSIVWIGGILRGWFWKKFCWMDGSCWDFGYWAPGQPGSGGGHCVTLCTKGGHWRRASCKSHLPFICSF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6.14 | 6.14017328241701 | 0.00035 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)