Bacterial taxon 208964
Protein WP_003088542.1
pyrroloquinoline quinone biosynthesis peptide chaperone PqqD
Pseudomona aeruginosa PA01
Gene pqqD, UniProt Q9I2C1
>WP_003088542.1|Pseudomona aeruginosa PA01|pyrroloquinoline quinone biosynthesis peptide chaperone PqqD
MSLPSLDSVPMLRRGFRFQFEPAQDCHVLLYPEGMVKLNDSAGEILKLVDGRRDVAAIVAALRERFPEVPGIDEDILAFLEVAHAQFWIELQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ -2.72 | -2.71848282670372 | 5.7e-9 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 51.5 ms
(Link to these results)