Host taxon 10090
Protein NP_598423.1
radiation-inducible immediate-early gene IEX-1
Mus musculus
Gene Ier3, UniProt Q91VZ5
>NP_598423.1|Pseudomona aeruginosa PA01|radiation-inducible immediate-early gene IEX-1
MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFLQQHPAAF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 9.42 | 9.42455331078731 | 7.6e-93 | 32071273 | |
Retrieved 1 of 1 entries in 41.7 ms
(Link to these results)