Host taxon 10090
Protein NP_001272370.1
ran guanine nucleotide release factor isoform 1
Mus musculus
Gene Rangrf, UniProt Q9JIB0
>NP_001272370.1|Pseudomona aeruginosa PA01|ran guanine nucleotide release factor isoform 1
MPTVRRSHRTPLIPALGRQRQAEFLNSTPAWSTDDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYHFEDVGRVQGARAVHVLSVQPLCLENLSLRGCCQDAWSLSGKQQVAKENQQVAKDVTLHQALLRLPQYQTDLLLTFNQPPCHSRSLGPENLSCPPWSLSNFEQLVTSLTLHDPNLFGPQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.52 | -4.52084396104914 | 0.00046 | 32071273 | |
Retrieved 1 of 1 entries in 37.5 ms
(Link to these results)