Host taxon 10090
Protein NP_001013404.1
ras-like protein family member 10B isoform 1 precursor
Mus musculus
Gene Rasl10b, UniProt Q5SSG5
>NP_001013404.1|Pseudomona aeruginosa PA01|ras-like protein family member 10B isoform 1 precursor
MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTTRRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.37 | 3.36517898245452 | 1.2e-33 | 32071273 | |
Retrieved 1 of 2 entries in 90 ms
(Link to these results)