Host taxon 10090
Protein NP_663505.1
rho-related GTP-binding protein RhoV
Mus musculus
Gene Rhov, UniProt Q8VDU1
>NP_663505.1|Pseudomona aeruginosa PA01|rho-related GTP-binding protein RhoV
MPPRELSEAEPPPLPASTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.93 | 3.92726826898564 | 3.8e-16 | 32071273 | |
Retrieved 1 of 1 entries in 33.2 ms
(Link to these results)