Host taxon 10090
Protein NP_780345.1
RING finger protein 122 isoform 4
Mus musculus
Gene Rnf122, UniProt Q8BP31
>NP_780345.1|Pseudomona aeruginosa PA01|RING finger protein 122 isoform 4
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIAGPTETSQSIGILLDELV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.83 | 2.82605818477084 | 2.8e-71 | 32071273 | |
Retrieved 1 of 2 entries in 58.3 ms
(Link to these results)