Bacterial taxon 208964
Protein WP_003096781.1
sarcosine oxidase subunit delta
Pseudomona aeruginosa PA01
Gene soxD, UniProt Q9HTE7
>WP_003096781.1|Pseudomona aeruginosa PA01|sarcosine oxidase subunit delta
MLNIFCPHCGELRSEEEFHAKGQAHIPRPLDPNACSDEEWGDYMFFRDNPRGLHHELWVHAAGCRKYFNVTRHTVTYEILETYLIGEQPSVVADGEKKPAVQGEPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -4.67 | -4.66663511480023 | 0.00065 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 28.2 ms
(Link to these results)