Bacterial taxon 208964
Protein WP_010895582.1
SctI family type III secretion system inner rod subunit PscI
Pseudomona aeruginosa PA01
Gene pscI, UniProt Q9I315
>WP_010895582.1|Pseudomona aeruginosa PA01|SctI family type III secretion system inner rod subunit PscI
MDISRMGAQAQITSLEELSGGPAGAAHVAEFERAMGGAGSLGGDLLSELGQIRERFSQAKQELQMELSTPGDDPNSLMQMQWSLMRITMQEELIAKTVGRMSQNVETLMKTQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 5.2 | 5.19578119403056 | 4.4e-189 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)