Host taxon 10090
Protein NP_033143.1
serum amyloid A-1 protein precursor
Mus musculus
Gene Saa1, UniProt P05366
>NP_033143.1|Pseudomona aeruginosa PA01|serum amyloid A-1 protein precursor
MKLLTSLVFCSLLLGVCHGGFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6.75 | 6.75075644396574 | 2.0e-16 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)