Host taxon 10090
Protein NP_035445.1
serum amyloid A-3 protein precursor
Mus musculus
Gene Saa3, UniProt P04918
>NP_035445.1|Pseudomona aeruginosa PA01|serum amyloid A-3 protein precursor
MKPSIAIILCILILGVDSQRWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.17 | 7.16759413573707 | 2.8e-288 | 32071273 | |
Retrieved 1 of 1 entries in 48.2 ms
(Link to these results)