Bacterial taxon 208964
Protein WP_003088185.1
sigma-70 family RNA polymerase sigma factor
Pseudomona aeruginosa PA01
Gene femI, UniProt Q9I2J2
>WP_003088185.1|Pseudomona aeruginosa PA01|sigma-70 family RNA polymerase sigma factor
MPPADASLHDAVSHLYQDHHGWLQGWLRRRLGCAENAADLAQDTFARLLASRRVLDAREPRAYLTTVAKGLMINWFQRQSLERAYLDALANLPEDLAPPPEQRLMVLETLHEVDALLGSLPDRVRQAFLLAQIEGLKYEAIAERLGVSLGSVKRYMQQAFRQCLELME
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ 2.9 | 2.89763037419184 | 3.3e-22 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 22.6 ms
(Link to these results)