Host taxon 10090
Protein NP_598894.1
small integral membrane protein 3
Mus musculus
Gene Smim3, UniProt Q99PE5
>NP_598894.1|Pseudomona aeruginosa PA01|small integral membrane protein 3
MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.88 | 3.87614412673885 | 9.4e-195 | 32071273 | |
Retrieved 1 of 2 entries in 2.7 ms
(Link to these results)