Host taxon 10090
Protein NP_998780.2
SP140 nuclear body protein family member
Mus musculus
Gene A530032D15Rik, UniProt E9PV05
>NP_998780.2|Pseudomona aeruginosa PA01|SP140 nuclear body protein family member
MAGGDNELSSRTIPEDQNEEESDDYQLMFKHFKENKVEIASAITKPFPFLMSLRDRDFISEQKFQEYQETCKNLAPVERVVYDILSNVQKKFSRDLLKVIFSKTHLKVYPDLKETLKHFFLNASKTNDEQAEEMLSLPQCNGGVLAQEHSNPHVKRSVPVSCVPQHMCQKTWKQGWEAAKEKVWAPGGTFLQENPRSRESWQVWSLHCRPW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.94 | 3.94459008612696 | 1.8e-24 | 32071273 | |
Retrieved 1 of 2 entries in 8.6 ms
(Link to these results)