Bacterial taxon 208964
Protein WP_003091727.1
STAS domain-containing protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9HYP8
>WP_003091727.1|Pseudomona aeruginosa PA01|STAS domain-containing protein
MAITALPSADGQELTIQIQGRFDFGAHQDFRDAYERVAITPRRYVVDLRNATYLDSSALGMLLLLRDHAGGENAQISLANCSPEVRKILAISNFEQLFKIS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ -3.95 | -3.95405496590038 | 6.6e-164 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 32.8 ms
(Link to these results)