Host taxon 10090
Protein NP_001076015.1
stefin A-like protein
Mus musculus
Gene Cstdc5, UniProt Q497J0
>NP_001076015.1|Pseudomona aeruginosa PA01|stefin A-like protein
MSLGGVSEASRATPEIQKIADKVRPQLEAKTNKKYEKFEAVEYKTQAVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTKDDELTYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.18 | 5.17792885699714 | 7.2e-26 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)