Host taxon 10090
Protein NP_776294.1
stefin A2 like 1
Mus musculus
Gene Stfa2l1, UniProt Q8BWM3
>NP_776294.1|Pseudomona aeruginosa PA01|stefin A2 like 1
MTEYTRKIKGGLSEARPATSEIQEIADKVRLLLEEKTNEKYEKFKAIEYKVQVVQGLNYFIKMDVGRGCYLHINVLSGISSENDLELTGYQTNKAKNDELTYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.51 | 5.51138681462033 | 2.0e-53 | 32071273 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)