Host taxon 10090
Protein NP_033390.1
tissue factor pathway inhibitor 2 precursor
Mus musculus
Gene Tfpi2, UniProt O35536
>NP_033390.1|Pseudomona aeruginosa PA01|tissue factor pathway inhibitor 2 precursor
MDPAMPLQLWNLPLLLVGSVLGLTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.45 | 4.45113146555501 | 3.0e-40 | 32071273 | |
Retrieved 1 of 2 entries in 55.2 ms
(Link to these results)