Host taxon 10090
Protein NP_001162086.1
TRAF-interacting protein with FHA domain-containing protein B
Mus musculus
Gene Tifab, UniProt Q8JZM6
>NP_001162086.1|Pseudomona aeruginosa PA01|TRAF-interacting protein with FHA domain-containing protein B
MERPLTVLQVSLYHPTQGPVAFAHVPQQLQHDASRLLVGRGQNTHLQLQLPQLSRYHLSLEPYLEKGSSLLAFCLKVLTRKSCVWVNGLPLRYLEQVPLGTINRISFSGIQMLVRKEGGASLETFVCYFHLSPSPLIYRPKAQETDE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.92 | -4.92340202446143 | 6.2e-13 | 32071273 | |
Retrieved 1 of 1 entries in 20.4 ms
(Link to these results)