Host taxon 10090
Protein NP_001288734.1
transcription factor HES-2
Mus musculus
Gene Hes2, UniProt O54792
>NP_001288734.1|Pseudomona aeruginosa PA01|transcription factor HES-2
MRLPRRVEDAAELRKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFLQEQPATLYSSAAPGPLNSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLRQRTVSDDSPSLTLPPAPAPAPSPPVPPPGSSGLWRPW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.77 | -3.76954789442471 | 0.00014 | 32071273 | |
Retrieved 1 of 1 entries in 49.1 ms
(Link to these results)