Host taxon 10090
Protein NP_080114.1
transmembrane protein 107 isoform 1
Mus musculus
Gene Tmem107, UniProt Q9CPV0
>NP_080114.1|Pseudomona aeruginosa PA01|transmembrane protein 107 isoform 1
MGRISGLVPSRFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLTLGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTFCSAFPAVTETALFIAVFGLKKKPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.7 | -3.6967701384718 | 3.6e-6 | 32071273 | |
Retrieved 1 of 1 entries in 87.8 ms
(Link to these results)