Host taxon 10090
Protein NP_001028977.1
transmembrane protein 253
Mus musculus
Gene Tmem253, UniProt Q3UNB8
>NP_001028977.1|Pseudomona aeruginosa PA01|transmembrane protein 253
MDQNANQPRQERPSVRLEKLQHWARHKQSGRLLVLAVSQVWLAIAMVPFTISVSCLTSACHLVTALPLWPGASGLLTGIITLELRRAPCIWKVRAMMISNTFNLILGFVAVVIEVMKTALGTASMDSSQSTGLLVLELSAEAFTLAGVLVSTYALFLLSQRKPGYFKRSRLQYRELQEGLSEMEEVSGLENGPVVASTGNRTDE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.64 | -3.64080870452964 | 0.0015 | 32071273 | |
Retrieved 1 of 1 entries in 66.1 ms
(Link to these results)