Bacterial taxon 208964
Protein WP_003102879.1
type 1 glutamine amidotransferase
Pseudomona aeruginosa PA01
Gene pfpI, UniProt Q9I6D8
>WP_003102879.1|Pseudomona aeruginosa PA01|type 1 glutamine amidotransferase
MTQSLHGKVVAALVTDGFEQVELTGPKKALEDAGATVRILSDKAGEVRGWNHHQPAEAFRVDGTFEDASLDDYDALLLPGGVINSDQIRSLAKAQELAIRAEQASKPVAVICHGAWLLISAGLVQGRTLTSWPSLKDDINNAGGHWVDQEVAVDGKLVSSRKPEDIPAFNRRFIEILAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ -3.89 | -3.88679477639293 | 1.5e-49 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 45.2 ms
(Link to these results)