Bacterial taxon 208964
Protein WP_003114978.1
type 4b pilus Flp major pilin
Pseudomona aeruginosa PA01
Gene flp, UniProt Q9HW94
>WP_003114978.1|Pseudomona aeruginosa PA01|type 4b pilus Flp major pilin
MKNLTLFVYCKVRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPTAN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -7.54 | -7.53881009247002 | 1.1e-47 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 21.6 ms
(Link to these results)