Bacterial taxon 208964
Protein WP_003092213.1
type B 50S ribosomal protein L31
Pseudomona aeruginosa PA01
Gene rpmE2, UniProt Q9HY25
>WP_003092213.1|Pseudomona aeruginosa PA01|type B 50S ribosomal protein L31
MKPGIHPEYRPVLFHDTSADVYFLIGSTAETDKTHTHTDGKTYPYVTLDVSSASHPVYTGEQRKTKSEGRVAGFNKRFAGFVGGKGA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ 2.98 | 2.97743413163971 | 5.5e-63 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)