Bacterial taxon 208964
Protein WP_003087729.1
type III secretion system needle filament protein PscF
Pseudomona aeruginosa PA01
Gene pscF, UniProt P95434
>WP_003087729.1|Pseudomona aeruginosa PA01|type III secretion system needle filament protein PscF
MAQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 4.56 | 4.56260073348546 | 6.9e-125 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 27 ms
(Link to these results)