Host taxon 10090
Protein NP_056598.2
ubiquitin-like protein ISG15
Mus musculus
Gene Isg15, UniProt Q64339
>NP_056598.2|Pseudomona aeruginosa PA01|ubiquitin-like protein ISG15
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.94 | 4.94177855476634 | 8.5e-123 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)