Host taxon 10090
Protein NP_001094989.1
uncharacterized protein CFAP97D2
Mus musculus
Gene Cfap97d2, UniProt G3UW36
>NP_001094989.1|Pseudomona aeruginosa PA01|uncharacterized protein CFAP97D2
MHRVPRLTTPWANRDLQRAWEKTYQDHRKKVQNAQPLVDTHPPQIYSHLCLKFKKLKMEEERLSIIDRNNYLLLQRVASAMKTRGQTDGRNNFTQRRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.41 | -3.40544610590232 | 0.0011 | 32071273 | |
Retrieved 1 of 1 entries in 3 ms
(Link to these results)