Host taxon 10090
Protein NP_001033018.1
uncharacterized protein LOC627302
Mus musculus
Gene Gm14092, UniProt Q3V0I6
>NP_001033018.1|Pseudomona aeruginosa PA01|uncharacterized protein LOC627302
MQFPLYQGFTSQSRSLKCTIWKMSPRLATEEREEKNLKRRKHCQKVRSKSLGNSLGFATASLAEGTGAGTPHQSRFCFCKADSKRSQRWSFLEYHKRPLSFLFSQISPAMEV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.62 | -4.61996122177748 | 0.011 | 32071273 | |
Retrieved 1 of 1 entries in 81.6 ms
(Link to these results)