Host taxon 10090
Protein NP_001012741.2
WAP four-disulfide core domain 16
Mus musculus
Gene Wfdc16, UniProt Q5DQQ4
>NP_001012741.2|Pseudomona aeruginosa PA01|WAP four-disulfide core domain 16
MSPVGLMKWQVTLQMLLLLGTLGLPVLARWKDRYFSEIQIQDYILTRPKLPPCLTRPTSTQCTSYCRAHLDCEQDFHCCRSFCGNVCMSPEEAEGAKPNHTIRNSVSTVVP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.45 | -4.44877453771769 | 0.018 | 32071273 | |
Retrieved 1 of 2 entries in 57.9 ms
(Link to these results)