Bacterial taxon 208964
Protein WP_003086910.1
YciI family protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9I3Z0
>WP_003086910.1|Pseudomona aeruginosa PA01|YciI family protein
MRFMVIVKATQASEAGEMPSEELLAAMGRYNEELVKAGVMLAGEGLQPSAKGARVRFSGNARTVIDGPFAETRELIAGFWMFQVASLEEAIEWVKRCPNPFDGESEIEIRQVFEAEDFGEEFTPELREREERLRAELEKRN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -4.3 | -4.29941274279173 | 2.9e-22 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 66.2 ms
(Link to these results)