Bacterial taxon 208964
Protein WP_003100725.1
YopR family T3SS polymerization control protein PscH
Pseudomona aeruginosa PA01
Gene pscH, UniProt Q9I316
>WP_003100725.1|Pseudomona aeruginosa PA01|YopR family T3SS polymerization control protein PscH
MSRIDTPPGFAVYPSASPKAANLPAVDQVLAFEQALGGEPPAAGRRLAGLENGALGERLLQRFAQPLQGLEADRLELKAMLRAELPLGRQQQTFLLQLLGAVEHAPGGEYLAQLARRELQVLIPLNGMLDNLVRNSHKLDLES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 5.15 | 5.15398715980616 | 1.5e-158 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 25.5 ms
(Link to these results)