Bacterial taxon 208964
Protein WP_003115377.1
YscE family type III secretion system co-chaperone PscE
Pseudomona aeruginosa PA01
Gene pscE, UniProt Q9I317
>WP_003115377.1|Pseudomona aeruginosa PA01|YscE family type III secretion system co-chaperone PscE
MMTALETRLSVADGTHAAALRQRLQAALAECRRELARGACPEHFQFLQQQARALEGGLGILSQLTED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 4.53 | 4.52807950993786 | 1.1e-96 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 28.1 ms
(Link to these results)