Bacterial taxon 208964
Protein WP_003100735.1
YscG family type III secretion system chaperone PscG
Pseudomona aeruginosa PA01
Gene pscG, UniProt P95435
>WP_003100735.1|Pseudomona aeruginosa PA01|YscG family type III secretion system chaperone PscG
MDTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQDEAARLIRISSLANQGRYQEALAFAHGNPWPALEPWFALCEWHLGLGAALDRRLAGLGGSSDPALADFAAGMRAQVRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 5.03 | 5.03217522250094 | 9.4e-188 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)