Host taxon 10090
Protein NP_001264168.1
zinc finger matrin-type protein 4 isoform 2
Mus musculus
Gene Zmat4, UniProt Q8BZ94
>NP_001264168.1|Pseudomona aeruginosa PA01|zinc finger matrin-type protein 4 isoform 2
MVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPLSSLKAPRVDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYEGKKHKKNAARVALLEQLGTSLDLGELRGLRRTYRCTTCSVSLNSIEQYHAHLQGSKHQTNLKNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -6.55 | -6.55156885426357 | 2.6e-6 | 32071273 | |
Retrieved 1 of 1 entries in 64.1 ms
(Link to these results)