Host taxon 9606
Protein NP_001001437.2
C-C motif chemokine 3-like 1 precursor
Homo sapiens
Gene n/a, UniProt P16619
>NP_001001437.2|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|C-C motif chemokine 3-like 1 precursor
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Monocytic infected cells | 24 h | ●●●●● 4.45 | 4.45344795295812 | 0.035 | 32071273 | |
Retrieved 1 of 1 entries in 17.7 ms
(Link to these results)