Bacterial taxon 216597
Protein WP_000218080.1
flagella biosynthesis regulatory protein FliZ
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene fliZ, UniProt A0A0H3NCH8
>WP_000218080.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|flagella biosynthesis regulatory protein FliZ
MTVQQPKRRPLSRYLKDFKHSQTHCAHCHKLLDRITLVRRGKIVNKIAISQLDMLLDDAAWQREQKEWVALCRFCGDLHCKKQSDFFDIIGFKQYLFEQTEMSHGTVREYVVRLRRLGNYLSEQNISHDLLQDGFLDESLAPWLPETSTNNYRIALRKYQQYKAHQQIAPRQKSPFTASSDIY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●● -4.16 | -4.16124451227102 | 0.0012 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●○ -3.81 | -3.8087901434569 | 0.013 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 8.7 ms
(Link to these results)